PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_4CF7C00FE.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 263aa    MW: 27719.6 Da    PI: 9.1311
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_4CF7C00FE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.92.9e-3563116558
                 zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                              +cprC s +tkfCyynny++sqPr+fC+aCrryWt GG+lrnvP+Gg++rk+
  Traes_4DS_4CF7C00FE.1  63 REQCPRCASYDTKFCYYNNYNTSQPRHFCRACRRYWTLGGSLRNVPIGGSTRKR 116
                            579*************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-3164116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.36364118IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-2265111IPR003851Zinc finger, Dof-type
PROSITE patternPS01361066102IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MEAPLHQLAP MQQALLAHPQ NCKHDAAATM AATDMACLQQ QQQQLMQLQP AAANPNTPSG  60
AAREQCPRCA SYDTKFCYYN NYNTSQPRHF CRACRRYWTL GGSLRNVPIG GSTRKRLRPA  120
PQQAMRRPPV HFGAPPPPMP AQSHSQQAPQ GGLLSSLFAL GAAPLFEGRV GFDLGLGLPG  180
LSQVGLGGSA GEFGLHSLGL RGGHAGTSAP MLWPTAFLDN GNVDTWKVSG GGAAAMWAPE  240
FSPAPAVAQV GGNGMFHGGA QIM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3748300.0AK374830.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3077I02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559674.21e-81PREDICTED: dof zinc finger protein DOF1.7-like
TrEMBLW5EQ740.0W5EQ74_WHEAT; Uncharacterized protein
STRINGBRADI1G14570.13e-65(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.17e-27DOF zinc finger protein 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]